CNDP2 (NM_018235) Human Recombinant Protein
CAT#: TP300120
Recombinant protein of human CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), 20 µg
View other "CNDP2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200120 protein sequence
Red=Cloning site Green=Tags(s) MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060705 |
| Locus ID | 55748 |
| UniProt ID | Q96KP4 |
| Refseq Size | 5089 |
| Cytogenetics | 18q22.3 |
| Refseq ORF | 1425 |
| Synonyms | CN2; CPGL; HEL-S-13; HsT2298; PEPA |
| Summary | CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM, Mar 2008] |
| Protein Families | Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413215 | CNDP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432984 | CNDP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413215 | Transient overexpression lysate of CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), transcript variant 1 |
CNY 3080.00 |
|
| LY432984 | Transient overexpression lysate of CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), transcript variant 2 |
CNY 3080.00 |
|
| PH300120 | CNDP2 MS Standard C13 and N15-labeled recombinant protein (NP_060705) |
CNY 19520.00 |
