ARMC1 (NM_018120) Human Recombinant Protein
CAT#: TP300135
Recombinant protein of human armadillo repeat containing 1 (ARMC1), 20 µg
View other "ARMC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200135 protein sequence
Red=Cloning site Green=Tags(s) MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECR ANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNK RAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQ VVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF YW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060590 |
Locus ID | 55156 |
UniProt ID | Q9NVT9 |
Refseq Size | 3051 |
Cytogenetics | 8q13.1 |
Refseq ORF | 846 |
Synonyms | Arcp |
Summary | In association with mitochondrial contact site and cristae organizing system (MICOS) complex components and mitochondrial outer membrane sorting assembly machinery (SAM) complex components may regulate mitochondrial dynamics playing a role in determining mitochondrial length, distribution and motility.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413306 | ARMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413306 | Transient overexpression lysate of armadillo repeat containing 1 (ARMC1) |
CNY 3080.00 |
|
PH300135 | ARMC1 MS Standard C13 and N15-labeled recombinant protein (NP_060590) |
CNY 19520.00 |