DUSP23 (NM_017823) Human Recombinant Protein
CAT#: TP300171
Recombinant protein of human dual specificity phosphatase 23 (DUSP23), 20 µg
View other "DUSP23" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200171 protein sequence
Red=Cloning site Green=Tags(s) MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060293 |
| Locus ID | 54935 |
| UniProt ID | Q9BVJ7 |
| Refseq Size | 718 |
| Cytogenetics | 1q23.2 |
| Refseq ORF | 450 |
| Synonyms | DUSP25; LDP-3; LDP3; MOSP; VHZ |
| Summary | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402621 | DUSP23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402621 | Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) |
CNY 3080.00 |
|
| PH300171 | DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293) |
CNY 19520.00 |
