NT5C2 (NM_012229) Human Recombinant Protein
CAT#: TP300194
Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1, 20 µg
View other "NT5C2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200194 protein sequence
Red=Cloning site Green=Tags(s) MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE E myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 64.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036361 |
| Locus ID | 22978 |
| UniProt ID | P49902 |
| Refseq Size | 3551 |
| Cytogenetics | 10q24.32-q24.33 |
| Refseq ORF | 1683 |
| Synonyms | cN-II; GMP; NT5B; PNT5; SPG45; SPG65 |
| Summary | This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides. [provided by RefSeq, Oct 2011] |
| Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415891 | NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427403 | NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415891 | Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1 |
CNY 3080.00 |
|
| LY427403 | Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2 |
CNY 3080.00 |
|
| PH300194 | NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_036361) |
CNY 19520.00 |
|
| PH325961 | NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_001127845) |
CNY 19520.00 |
|
| TP325961 | Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2, 20 µg |
CNY 2900.00 |
