ACAA1 (NM_001607) Human Recombinant Protein
CAT#: TP300213
Recombinant protein of human acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "ACAA1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200213 protein sequence
Red=Cloning site Green=Tags(s) MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE YPGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001598 |
| Locus ID | 30 |
| UniProt ID | P09110 |
| Refseq Size | 1840 |
| Cytogenetics | 3p22.2 |
| Refseq ORF | 1272 |
| Synonyms | ACAA; PTHIO; THIO |
| Summary | This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Biosynthesis of unsaturated fatty acids, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Valine, leucine and isoleucine degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400605 | ACAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427202 | ACAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400605 | Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY427202 | Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), transcript variant 2 |
CNY 3080.00 |
|
| PH300213 | ACAA1 MS Standard C13 and N15-labeled recombinant protein (NP_001598) |
CNY 19520.00 |
