SAM68 (KHDRBS1) (NM_006559) Human Recombinant Protein
CAT#: TP300263
Recombinant protein of human KH domain containing, RNA binding, signal transduction associated 1 (KHDRBS1), 20 µg
View other "SAM68" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200263 representing NM_006559
Red=Cloning site Green=Tags(s) MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR PSLKAPPARPVKGAYREHPYGRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006550 |
Locus ID | 10657 |
UniProt ID | Q07666 |
Refseq Size | 2685 |
Cytogenetics | 1p35.2 |
Refseq ORF | 1329 |
Synonyms | p62; p68; Sam68 |
Summary | This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012] |
Protein Families | Transcription Factors |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Intronic tRNAs of mitochondrial origin regulate constitutive and alternative splicing
,Hoser, SM;Hoffmann, A;Meindl, A;Gamper, M;Fallmann, J;Bernhart, SH;Müller, L;Ploner, M;Misslinger, M;Kremser, L;Lindner, H;Geley, S;Schaal, H;Stadler, PF;Huettenhofer, A;,
Genome biology
,PubMed ID 33292386
[KHDRBS1]
|
Sam68 Allows Selective Targeting of Human Cancer Stem Cells.
,null,
Cell chemical biology
,PubMed ID 28648376
[KHDRBS1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416574 | KHDRBS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416574 | Transient overexpression lysate of KH domain containing, RNA binding, signal transduction associated 1 (KHDRBS1) |
CNY 3080.00 |
|
PH300263 | KHDRBS1 MS Standard C13 and N15-labeled recombinant protein (NP_006550) |
CNY 19520.00 |