MDH1 (NM_005917) Human Recombinant Protein
CAT#: TP300298
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), 20 µg
View other "MDH1" proteins (6)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC200298 protein sequence Red=Cloning site Green=Tags(s) MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 36.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005908 | 
| Locus ID | 4190 | 
| UniProt ID | P40925 | 
| Refseq Size | 1665 | 
| Cytogenetics | 2p15 | 
| Refseq ORF | 1002 | 
| Synonyms | DEE88; EIEE88; HEL-S-32; KAR; MDH-s; MDHA; MGC:1375; MOR2 | 
| Summary | This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401788 | MDH1 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC434177 | MDH1 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY401788 | Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1) | CNY 3080.00 | |
| LY434177 | Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1 | CNY 3080.00 | |
| PH300298 | MDH1 MS Standard C13 and N15-labeled recombinant protein (NP_005908) | CNY 19520.00 | |
| TP720248 | Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1. | CNY 1800.00 | 


 
                        
 
        