ARPC2 (NM_005731) Human Recombinant Protein
CAT#: TP300319
Recombinant protein of human actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2, 20 µg
View other "ARPC2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200319 protein sequence
Red=Cloning site Green=Tags(s) MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAH GADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGEN RAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELK DTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRA RPDAEKKEMKTITGKTFSSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005722 |
Locus ID | 10109 |
UniProt ID | O15144 |
Refseq Size | 1419 |
Cytogenetics | 2q35 |
Refseq ORF | 900 |
Synonyms | ARC34; p34-Arc; PNAS-139; PRO2446 |
Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008] |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Tumor-associated autoantibodies from mouse breast cancer models are found in serum of breast cancer patients
,Stanton, S;Gad, E;Ramos, E;Corulli, L;Annis, J;Childs, J;Katayama, H;Hanash, S;Marks, J;Disis, M;,
npj Breast Cancer
,PubMed ID 33976232
[ARPC2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407180 | ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417111 | ARPC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407180 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 1 |
CNY 3080.00 |
|
LY417111 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 2, 34kDa (ARPC2), transcript variant 2 |
CNY 3080.00 |
|
PH300319 | ARPC2 MS Standard C13 and N15-labeled recombinant protein (NP_005722) |
CNY 19520.00 |