Ferredoxin Reductase (FDXR) (NM_024417) Human Recombinant Protein
CAT#: TP300363
Recombinant protein of human ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "Ferredoxin Reductase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200363 representing NM_024417
Red=Cloning site Green=Tags(s) MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG H myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_077728 |
| Locus ID | 2232 |
| UniProt ID | P22570 |
| Refseq Size | 1918 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 1473 |
| Synonyms | ADR; ADXR; ANOA |
| Summary | This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402986 | FDXR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418195 | FDXR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402986 | Transient overexpression lysate of ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY418195 | Transient overexpression lysate of ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4840.00 |
|
| PH300363 | FDXR MS Standard C13 and N15-labeled recombinant protein (NP_077728) |
CNY 19520.00 |
其它Ferredoxin Reductase产品
