DDX5 (NM_004396) Human Recombinant Protein
CAT#: TP300371
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5), 20 µg
View other "DDX5" proteins (3)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 4 publications. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC200371 protein sequence Red=Cloning site Green=Tags(s) MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 69 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Phosphorylation substrate (PMID: 25649741) Binding assay (PMID: 27148684) | 
| Reference Data | |
| RefSeq | NP_004387 | 
| Locus ID | 1655 | 
| UniProt ID | P17844 | 
| Refseq Size | 3769 | 
| Cytogenetics | 17q23.3 | 
| Refseq ORF | 1842 | 
| Synonyms | G17P1; HLR1; HUMP68; p68 | 
| Summary | This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017] | 
| Protein Pathways | Spliceosome | 
Citations (4)
| The use of this Proteins has been cited in the following citations: | 
|---|
| DDX5-targeting fully human monoclonal autoantibody inhibits proliferation and promotes differentiation of acute promyelocytic leukemia cells by increasing ROS production
                                                ,Wu, J;You, YQ;Ma, YX;Kang, YH;Wu, T;Wu, XJ;Hu, XX;Meng, QH;Huang, Y;Zhang, N;Pan, XB;,
                                                Cell Death Dis
                                                ,PubMed ID 32690860
                                                [DDX5] | 
| ATAD5 restricts R-loop formation through PCNA unloading and RNA helicase maintenance at the replication fork
                                                ,Kim, S;Kang, N;Park, SH;Wells, J;Hwang, T;Ryu, E;Kim, BG;Hwang, S;Kim, SJ;Kang, S;Lee, S;Stirling, P;Myung, K;Lee, KY;,
                                                Nucleic Acids Res.
                                                ,PubMed ID 32542338
                                                [DDX5] | 
| Resveratrol directly targets DDX5 resulting in suppression of the mTORC1 pathway in prostate cancer
                                                ,Taniguchi, T;Iizumi, Y;Watanabe, M;Masuda, M;Morita, M;Aono, Y;Toriyama, S;Oishi, M;Goi, W;Sakai, T;,
                                                Cell Death Dis
                                                ,PubMed ID 27148684
                                                [DDX5] | 
| A Novel Anti-Cancer Agent, 1-(3, 5-Dimethoxyphenyl)-4-[(6-fluoro-2-methoxyquinoxalin-3-yl)aminocarbonyl] piperazine (RX-5902),Interferes with ß-Catenin Function through Y593 phospho-p68RNA Helicase
                                                ,Kost, GC;Yang, MY;Li, L;Zhang, Y;Liu, CY;Kim, DJ;Ahn, CH;Lee, YB;Liu, ZR;,
                                                J. Cell. Biochem.
                                                ,PubMed ID 25649741
                                                [DDX5] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401398 | DDX5 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY401398 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5) | CNY 3080.00 | |
| PH300371 | DDX5 MS Standard C13 and N15-labeled recombinant protein (NP_004387) | CNY 19520.00 | 


 
                         
                            

 
        