CORO2A (NM_003389) Human Recombinant Protein
CAT#: TP300403
Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 1, 20 µg
View other "CORO2A" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200403 protein sequence
Red=Cloning site Green=Tags(s) MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGK LDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEW HPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPR AGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDA DTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLI EPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMA PASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQ QEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003380 |
Locus ID | 7464 |
UniProt ID | Q92828 |
Refseq Size | 5657 |
Cytogenetics | 9q22.33 |
Refseq ORF | 1575 |
Synonyms | CLIPINB; IR10; WDR2 |
Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403258 | CORO2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418681 | CORO2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403258 | Transient overexpression lysate of coronin, actin binding protein, 2A (CORO2A), transcript variant 2 |
CNY 3080.00 |
|
LY418681 | Transient overexpression lysate of coronin, actin binding protein, 2A (CORO2A), transcript variant 1 |
CNY 3080.00 |
|
PH300403 | CORO2A MS Standard C13 and N15-labeled recombinant protein (NP_003380) |
CNY 19520.00 |
|
PH303993 | CORO2A MS Standard C13 and N15-labeled recombinant protein (NP_438171) |
CNY 19520.00 |
|
TP303993 | Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 2, 20 µg |
CNY 2900.00 |