PRKRA (NM_003690) Human Recombinant Protein
CAT#: TP300578
Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 20 µg
View other "PRKRA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200578 protein sequence
Red=Cloning site Green=Tags(s) MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003681 |
Locus ID | 8575 |
UniProt ID | O75569 |
Refseq Size | 1826 |
Cytogenetics | 2q31.2 |
Refseq ORF | 939 |
Synonyms | DYT16; HSD14; PACT; RAX |
Summary | This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401219 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427977 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427978 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401219 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1 |
CNY 3,080.00 |
|
LY427977 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2 |
CNY 3,080.00 |
|
LY427978 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3 |
CNY 3,080.00 |
|
PH300578 | PRKRA MS Standard C13 and N15-labeled recombinant protein (NP_003681) |
CNY 19,520.00 |