ID3 (NM_002167) Human Recombinant Protein
CAT#: TP300583L
Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3), 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200583 protein sequence 
Red=Cloning site Green=Tags(s) MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 12.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002158 | 
| Locus ID | 3399 | 
| UniProt ID | Q02535 | 
| Refseq Size | 1252 | 
| Cytogenetics | 1p36.12 | 
| Refseq ORF | 357 | 
| Synonyms | bHLHb25; HEIR-1 | 
| Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011] | 
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors | 
| Protein Pathways | TGF-beta signaling pathway | 
Documents
| FAQs | 
| SDS | 
