FSTL1 (NM_007085) Human Recombinant Protein
CAT#: TP300586
Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg
View other "FSTL1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200586 protein sequence
Red=Cloning site Green=Tags(s) MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE EEMTRYVQELQKHQETAEKTKRVSTKEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009016 |
Locus ID | 11167 |
UniProt ID | Q12841 |
Refseq Size | 3840 |
Cytogenetics | 3q13.33 |
Refseq ORF | 924 |
Synonyms | FRP; FSL1; MIR198; OCC-1; OCC1; tsc36 |
Summary | This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402088 | FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402088 | Transient overexpression lysate of follistatin-like 1 (FSTL1) |
CNY 3080.00 |
|
PH300586 | FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016) |
CNY 19520.00 |
|
TP720885 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |
|
TP721119 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |
|
TP721135 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |