FH (NM_000143) Human Recombinant Protein
CAT#: TP300614
Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200614 protein sequence
Red=Cloning site Green=Tags(s) MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA QTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVV WQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPG LQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVG TGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPR SGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELG YLTAEQFDEWVKPKDMLGPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000134 |
Locus ID | 2271 |
UniProt ID | P07954 |
Refseq Size | 1877 |
Cytogenetics | 1q43 |
Refseq ORF | 1530 |
Synonyms | FMRD; HLRCC; HsFH; LRCC; MCL; MCUL1 |
Summary | The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Metabolic pathways, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400053 | FH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400053 | Transient overexpression lysate of fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH300614 | FH MS Standard C13 and N15-labeled recombinant protein (NP_000134) |
CNY 19520.00 |
|
TP720199 | Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |