ICAM1 (NM_000201) Human Recombinant Protein
CAT#: TP300714
Purified recombinant protein of Homo sapiens intercellular adhesion molecule 1 (ICAM1), 20 µg
View other "ICAM1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200714 protein sequence
Red=Cloning site Green=Tags(s) MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAA VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000192 |
| Locus ID | 3383 |
| UniProt ID | P05362 |
| Refseq Size | 2986 |
| Cytogenetics | 19p13.2 |
| Refseq ORF | 1596 |
| Synonyms | BB2; CD54; P3.58 |
| Summary | This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400073 | ICAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400073 | Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) |
CNY 3080.00 |
|
| PH300714 | ICAM1 MS Standard C13 and N15-labeled recombinant protein (NP_000192) |
CNY 14250.00 |
|
| TP720283 | Recombinant protein of human intercellular adhesion molecule 1 (ICAM1) |
CNY 1800.00 |
|
| TP721375 | Recombinant mouse ICAM-1/CD54 protein |
CNY 1313.00 |
|
| TP723972 | Human ICAM-1 Protein, mFc Tag |
CNY 5249.00 |
