ACTR1A (NM_005736) Human Recombinant Protein
CAT#: TP300738
Recombinant protein of human ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A), 20 µg
View other "ACTR1A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200738 protein sequence
Red=Cloning site Green=Tags(s) MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLS IRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFIS MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSE FEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLV FAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL DTFKKMWVSKKEYEEDGARSIHRKTF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005727 |
| Locus ID | 10121 |
| UniProt ID | P61163 |
| Refseq Size | 2891 |
| Cytogenetics | 10q24.32 |
| Refseq ORF | 1128 |
| Synonyms | ARP1; Arp1A; CTRN1 |
| Summary | This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401749 | ACTR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401749 | Transient overexpression lysate of ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) |
CNY 3080.00 |
|
| PH300738 | ACTR1A MS Standard C13 and N15-labeled recombinant protein (NP_005727) |
CNY 14250.00 |
