HAGHL (NM_032304) Human Recombinant Protein
CAT#: TP300832
Recombinant protein of human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2, 20 µg
View other "HAGHL" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200832 protein sequence
Red=Cloning site Green=Tags(s) MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLR PGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAG CGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTV PSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAP HD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115680 |
| Locus ID | 84264 |
| UniProt ID | Q6PII5 |
| Refseq Size | 1386 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 846 |
| Summary | Hydrolase acting on ester bonds.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Pyruvate metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404116 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410246 | HAGHL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404116 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1 |
CNY 3080.00 |
|
| LY410246 | Transient overexpression lysate of hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 2 |
CNY 3080.00 |
|
| PH300832 | HAGHL MS Standard C13 and N15-labeled recombinant protein (NP_115680) |
CNY 19520.00 |
|
| TP761798 | Purified recombinant protein of Human hydroxyacylglutathione hydrolase-like (HAGHL), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
