HINFP (NM_015517) Human Recombinant Protein
CAT#: TP300864
Recombinant protein of human histone H4 transcription factor (HINFP), transcript variant 1, 20 µg
View other "HINFP" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200864 protein sequence
Red=Cloning site Green=Tags(s) MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQE CGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRNVIPDIPDHFLCLWEHCENSF DNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTFKDRSKLREHLRSHTQEKVVACPTCGGMFAN NTKFLDHIRRQTSLDQQHFQCSHCSKRFATERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSE DRPFKCDCCDYSCKNLIDLQKHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVC DKCFTRGNNLTVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLN ESSLQGIILETVPGEPGRKEEEEEGKGSEGTALSASQDNPSSVIHVVNQTNAQGQQEIVYYVLSEAPGEP PPVPEPPSGGIMEKLQGIAEEPEIQMV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056332 |
| Locus ID | 25988 |
| UniProt ID | Q9BQA5 |
| Refseq Size | 2374 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 1551 |
| Synonyms | HiNF-P; MIZF; ZNF743 |
| Summary | This gene encodes a transcription factor that interacts with methyl-CpG-binding protein-2 (MBD2), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Aug 2011] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403692 | HINFP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414491 | HINFP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403692 | Transient overexpression lysate of histone H4 transcription factor (HINFP), transcript variant 2 |
CNY 3080.00 |
|
| LY414491 | Transient overexpression lysate of histone H4 transcription factor (HINFP), transcript variant 1 |
CNY 3080.00 |
|
| PH300864 | HINFP MS Standard C13 and N15-labeled recombinant protein (NP_056332) |
CNY 19520.00 |
