RAP1GDS1 (NM_021159) Human Recombinant Protein
CAT#: TP300924
Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2, 20 µg
View other "RAP1GDS1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200924 protein sequence
Red=Cloning site Green=Tags(s) MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFATLLTPQSSCKAKVA NIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH LRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNL AELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVD SDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQ FKLLGTLRMLIDAQEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 66.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066982 |
| Locus ID | 5910 |
| UniProt ID | P52306 |
| Refseq Size | 3767 |
| Cytogenetics | 4q23 |
| Refseq ORF | 1821 |
| Synonyms | GDS1; SmgGDS |
| Summary | The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).[supplied by OMIM, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412050 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420266 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420268 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY412050 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2 |
CNY 3080.00 |
|
| LY420266 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 |
CNY 4840.00 |
|
| LY420268 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 |
CNY 4840.00 |
|
| PH300924 | RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_066982) |
CNY 19520.00 |
|
| PH312781 | RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_001093897) |
CNY 19520.00 |
|
| TP312781 | Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它RAP1GDS1产品
