GRHPR (NM_012203) Human Recombinant Protein
CAT#: TP300963
Recombinant protein of human glyoxylate reductase/hydroxypyruvate reductase (GRHPR), 20 µg
View other "GRHPR" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200963 protein sequence
Red=Cloning site Green=Tags(s) MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036335 |
| Locus ID | 9380 |
| UniProt ID | Q9UBQ7 |
| Refseq Size | 1235 |
| Cytogenetics | 9p13.2 |
| Refseq ORF | 984 |
| Synonyms | GLXR; GLYD; PH2 |
| Summary | This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415912 | GRHPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415912 | Transient overexpression lysate of glyoxylate reductase/hydroxypyruvate reductase (GRHPR) |
CNY 3080.00 |
|
| PH300963 | GRHPR MS Standard C13 and N15-labeled recombinant protein (NP_036335) |
CNY 19520.00 |
