H2AW (NM_033445) Human Recombinant Protein
CAT#: TP300984
Recombinant protein of human histone cluster 3, H2a (HIST3H2A), 20 µg
View other "H2AW" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200984 representing NM_033445
Red=Cloning site Green=Tags(s) MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_254280 |
| Locus ID | 92815 |
| UniProt ID | Q7L7L0 |
| Refseq Size | 496 |
| Cytogenetics | 1q42.13 |
| Refseq ORF | 390 |
| Synonyms | HIST3H2A |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409510 | HIST3H2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409510 | Transient overexpression lysate of histone cluster 3, H2a (HIST3H2A) |
CNY 3080.00 |
|
| PH300984 | HIST3H2A MS Standard C13 and N15-labeled recombinant protein (NP_254280) |
CNY 19520.00 |
|
| TP710343 | Purified recombinant protein of Human histone cluster 3, H2a (HIST3H2A), full length, with with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
