Mutarotase (GALM) (NM_138801) Human Recombinant Protein
CAT#: TP300995
Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM), 20 µg
View other "Mutarotase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200995 protein sequence
Red=Cloning site Green=Tags(s) MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_620156 |
| Locus ID | 130589 |
| UniProt ID | Q96C23 |
| Refseq Size | 2483 |
| Cytogenetics | 2p22.1 |
| Refseq ORF | 1026 |
| Synonyms | BLOCK25; GALAC4; GLAT; HEL-S-63p; IBD1 |
| Summary | This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.[provided by RefSeq, Mar 2009] |
| Protein Pathways | Glycolysis / Gluconeogenesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408487 | GALM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408487 | Transient overexpression lysate of galactose mutarotase (aldose 1-epimerase) (GALM) |
CNY 3080.00 |
|
| PH300995 | GALM MS Standard C13 and N15-labeled recombinant protein (NP_620156) |
CNY 19520.00 |
|
| TP720250 | Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM) |
CNY 1800.00 |
其它Mutarotase产品
