Sodium Potassium ATPase (ATP1A1) (NM_000701) Human Recombinant Protein
CAT#: TP301009
Recombinant protein of human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1, 20 µg
View other "Sodium Potassium ATPase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 2 publications. |
CNY 5381.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201009 protein sequence
Red=Cloning site Green=Tags(s) MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAE ILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVV IITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANG CKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG QTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQL SIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFL PDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKG VGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLI IVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD NLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQ RKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRM YPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 112.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000692 |
| Locus ID | 476 |
| UniProt ID | P05023 |
| Refseq Size | 3754 |
| Cytogenetics | 1p13.1 |
| Refseq ORF | 3069 |
| Synonyms | CMT2DD; HOMGSMR2 |
| Summary | The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cardiac muscle contraction |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The acaricidal mechanism and active compounds against Psoroptes cuniculi of the methanol extract of Adonis coerulea Maxim II: Integrated proteomics and SPR analysis
,Shang, XF;Miao, XL;Dai, LX;Guo, X;Li, B;Pan, H;Zhang, JY;,
Vet Parasitol
,PubMed ID 33091629
[ATP1A1]
|
|
Na+/K+-ATPase ?1 Identified as an Abundant Protein in the Blood-Labyrinth Barrier That Plays an Essential Role in the Barrier Integrity
,null,
PLoS ONE
,PubMed ID 21304972
[ATP1A1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424561 | ATP1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431659 | ATP1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY424561 | Transient overexpression lysate of ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1 |
CNY 3080.00 |
|
| LY431659 | Transient overexpression lysate of ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 3 |
CNY 4840.00 |
|
| PH301009 | ATP1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000692) |
CNY 19520.00 |
其它Sodium Potassium ATPase产品

