CDC42EP3 (NM_006449) Human Recombinant Protein
CAT#: TP301069
Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), 20 µg
View other "CDC42EP3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201069 protein sequence
Red=Cloning site Green=Tags(s) MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006440 |
Locus ID | 10602 |
UniProt ID | Q9UKI2 |
Refseq Size | 5715 |
Cytogenetics | 2p22.2 |
Refseq ORF | 762 |
Synonyms | BORG2; CEP3; UB1 |
Summary | This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416634 | CDC42EP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416634 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) |
CNY 3080.00 |
|
PH301069 | CDC42EP3 MS Standard C13 and N15-labeled recombinant protein (NP_006440) |
CNY 19520.00 |
其它CDC42EP3产品