RFC2 (NM_002914) Human Recombinant Protein
CAT#: TP301138
Recombinant protein of human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2, 20 µg
View other "RFC2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201138 protein sequence
Red=Cloning site Green=Tags(s) MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDSMTDGAQQALRRTMEIYSKTTRFALACNAS DKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFG FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKL EFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002905 |
Locus ID | 5982 |
UniProt ID | P35250 |
Refseq Size | 1657 |
Cytogenetics | 7q11.23 |
Refseq ORF | 960 |
Synonyms | RFC40 |
Summary | This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405777 | RFC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419017 | RFC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405777 | Transient overexpression lysate of replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 1 |
CNY 3080.00 |
|
LY419017 | Transient overexpression lysate of replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2 |
CNY 3080.00 |
|
PH301138 | RFC2 MS Standard C13 and N15-labeled recombinant protein (NP_002905) |
CNY 19520.00 |
|
TP320036 | Purified recombinant protein of human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg |
CNY 2900.00 |