Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Recombinant Protein
CAT#: TP301142
Recombinant protein of human protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3, 20 µg
View other "Protein Phosphatase 1 beta" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201142 protein sequence
Red=Cloning site Green=Tags(s) MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996759 |
Locus ID | 5500 |
UniProt ID | P62140 |
Refseq Size | 4786 |
Cytogenetics | 2p23.2 |
Refseq ORF | 981 |
Synonyms | HEL-S-80p; MP; NSLH2; PP-1B; PP1B; PP1beta; PP1c; PPP1beta; PPP1CD |
Summary | The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Differential regulation of protein phosphatase 1 (PP1) isoforms in human heart failure and atrial fibrillation.
,null,
Basic research in cardiology
,PubMed ID 28597249
[PPP1CB]
|
Inhibitory Member of the Apoptosis-stimulating Proteins of the p53 Family (iASPP) Interacts with Protein Phosphatase 1 via a Noncanonical Binding Motif
,Susana Llanos, Christophe Royer, Min Lu, Daniele Bergamaschi, Wen Hwa Lee, and Xin Lu,
J. Biol. Chem., Dec 2011; 286: 43039 - 43044.
[PPP1CB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400955 | PPP1CB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404146 | PPP1CB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400955 | Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 1 |
CNY 3080.00 |
|
LY404146 | Transient overexpression lysate of protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB), transcript variant 3 |
CNY 3080.00 |
|
PH301142 | PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759) |
CNY 19520.00 |
其它Protein Phosphatase 1 beta产品