PPIC (NM_000943) Human Recombinant Protein
CAT#: TP301143
Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC), 20 µg
View other "PPIC" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201143 protein sequence
Red=Cloning site Green=Tags(s) MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA DW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000934 |
Locus ID | 5480 |
UniProt ID | P45877 |
Refseq Size | 1241 |
Cytogenetics | 5q23.2 |
Refseq ORF | 636 |
Synonyms | CYPC |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424438 | PPIC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424438 | Transient overexpression lysate of peptidylprolyl isomerase C (cyclophilin C) (PPIC) |
CNY 3080.00 |
|
PH301143 | PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934) |
CNY 19520.00 |
|
TP720190 | Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC) |
CNY 1800.00 |