TIP49A (RUVBL1) (NM_003707) Human Recombinant Protein
CAT#: TP301170
Recombinant protein of human RuvB-like 1 (E. coli) (RUVBL1), 20 µg
View other "TIP49A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201170 protein sequence
Red=Cloning site Green=Tags(s) MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003698 |
| Locus ID | 8607 |
| UniProt ID | Q9Y265 |
| Refseq Size | 1785 |
| Cytogenetics | 3q21.3 |
| Refseq ORF | 1368 |
| Synonyms | ECP-54; ECP54; INO80H; NMP 238; NMP238; PONTIN; Pontin52; RVB1; TIH1; TIP49; TIP49A |
| Summary | This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Families | Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Wnt signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
RUVBL1 directly binds actin filaments and induces formation of cell protrusions to promote pancreatic cancer cell invasion.
,null,
International journal of oncology
,PubMed ID 24728183
[RUVBL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418487 | RUVBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418487 | Transient overexpression lysate of RuvB-like 1 (E. coli) (RUVBL1) |
CNY 3080.00 |
|
| PH301170 | RUVBL1 MS Standard C13 and N15-labeled recombinant protein (NP_003698) |
CNY 19520.00 |
