Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Recombinant Protein
CAT#: TP301211
Recombinant protein of human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1), 20 µg
View other "Suppressor of Ty 4 homolog 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201211 protein sequence
Red=Cloning site Green=Tags(s) MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 13 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003159 |
| Locus ID | 6827 |
| UniProt ID | P63272 |
| Refseq Size | 1545 |
| Cytogenetics | 17q22 |
| Refseq ORF | 351 |
| Synonyms | SPT4; SPT4H; Supt4a; SUPT4H |
| Summary | This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418857 | SUPT4H1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418857 | Transient overexpression lysate of suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1) |
CNY 3080.00 |
|
| PH301211 | SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159) |
CNY 19520.00 |
其它Suppressor of Ty 4 homolog 1产品
