TRAPPC6A (NM_024108) Human Recombinant Protein
CAT#: TP301311
Recombinant protein of human trafficking protein particle complex 6A (TRAPPC6A), 20 µg
View other "TRAPPC6A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201311 protein sequence
Red=Cloning site Green=Tags(s) MADTVLFEFLHTEMVAELWAHDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET LAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGL LRGALYTLGIESVVTASVAALPVCKFQVVIPKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077013 |
Locus ID | 79090 |
UniProt ID | O75865 |
Refseq Size | 838 |
Cytogenetics | 19q13.32 |
Refseq ORF | 519 |
Synonyms | TRS33 |
Summary | This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. Loss of expression of the related gene in mouse affects coat and eye pigmentation, suggesting that the encoded protein may be involved in melanosome biogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411342 | TRAPPC6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411342 | Transient overexpression lysate of trafficking protein particle complex 6A (TRAPPC6A) |
CNY 3080.00 |
|
PH301311 | TRAPPC6A MS Standard C13 and N15-labeled recombinant protein (NP_077013) |
CNY 19520.00 |
其它TRAPPC6A产品