PP2A-alpha (PPP2CA) (NM_002715) Human Recombinant Protein
CAT#: TP301334
Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA), 20 µg
View other "PP2A-alpha" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC201334 protein sequence 
Red=Cloning site Green=Tags(s) MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 35.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002706 | 
| Locus ID | 5515 | 
| UniProt ID | P67775 | 
| Refseq Size | 2643 | 
| Cytogenetics | 5q31.1 | 
| Refseq ORF | 927 | 
| Synonyms | NEDLBA; PP2Ac; PP2CA; PP2Calpha; RP-C | 
| Summary | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Phosphatase, Transcription Factors | 
| Protein Pathways | Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Covalent Ligand Discovery Against Druggable Hotspots Targeted by Anti-Cancer Natural Products
                                                ,null,
                                                Cell chemical biology
                                                ,PubMed ID 28919038
                                                [PPP2CA]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419151 | PPP2CA HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419151 | Transient overexpression lysate of protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA) | 
                                                     CNY 3080.00  | 
                                            |
| PH301334 | PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706) | 
                                                     CNY 19520.00  | 
                                            |
| TP750222 | Purified recombinant protein of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform , full length(266Ser, 269Ser), with N-terminal His tag, expressed in E.coli, 50ug | 
                                                     CNY 1950.00  | 
                                            
其它PP2A-alpha产品
