MYL12B (NM_033546) Human Recombinant Protein
CAT＃: TP301372
Recombinant protein of human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 20 µg
View other "MYL12B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201372 protein sequence
Red=Cloning site Green=Tags(s) MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYL DAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVD ELYREAPIDKKGNFNYIEFTRILKHGAKDKDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_291024 |
| Locus ID | 103910 |
| UniProt ID | O14950 |
| Refseq Size | 1022 |
| Cytogenetics | 18p11.31 |
| Refseq ORF | 516 |
| Synonyms | MLC-B; MRLC2 |
| Summary | The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403261 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428596 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428597 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428598 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403261 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2 |
CNY 3080.00 |
|
| LY428596 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1 |
CNY 3080.00 |
|
| LY428597 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3 |
CNY 3080.00 |
|
| LY428598 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4 |
CNY 3080.00 |
|
| PH301372 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024) |
CNY 19520.00 |
|
| PH327035 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) |
CNY 14250.00 |
|
| TP327035 | Purified recombinant protein of Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 20 µg |
CNY 2900.00 |
