EIF4EL3 (EIF4E2) (NM_004846) Human Recombinant Protein
CAT#: TP301391L
Recombinant protein of human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201391 protein sequence
Red=Cloning site Green=Tags(s) MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004837 |
Locus ID | 9470 |
UniProt ID | O60573 |
Refseq Size | 1078 |
Cytogenetics | 2q37.1 |
Refseq ORF | 735 |
Synonyms | 4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e |
Summary | Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Protein Pathways | Insulin signaling pathway, mTOR signaling pathway |
Documents
FAQs |
SDS |
其它EIF4EL3产品