MEIS2 (NM_002399) Human Recombinant Protein
CAT#: TP301395
Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg
View other "MEIS2" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201395 protein sequence
Red=Cloning site Green=Tags(s) MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGH PLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQV LRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDD ATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRA WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFV LDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002390 |
| Locus ID | 4212 |
| UniProt ID | O14770 |
| Refseq Size | 3074 |
| Cytogenetics | 15q14 |
| Refseq ORF | 1143 |
| Synonyms | CPCMR; HsT18361; MRG1 |
| Summary | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Development of small molecule inhibitors targeting PBX1 transcription signaling as a novel cancer therapeutic strategy
,null,
iScience
,PubMed ID 34816098
[MEIS2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406902 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406903 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406904 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406905 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419351 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406902 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b |
CNY 3080.00 |
|
| LY406903 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c |
CNY 4840.00 |
|
| LY406904 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d |
CNY 3080.00 |
|
| LY406905 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a |
CNY 3080.00 |
|
| LY419351 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f |
CNY 3080.00 |
|
| PH301395 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) |
CNY 19520.00 |
|
| PH308386 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776) |
CNY 19520.00 |
|
| PH322807 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) |
CNY 19520.00 |
|
| TP308386 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg |
CNY 2900.00 |
|
| TP322807 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg |
CNY 2900.00 |
