NPDC1 (NM_015392) Human Recombinant Protein
CAT#: TP301415
Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1), 20 µg
View other "NPDC1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201415 protein sequence
Red=Cloning site Green=Tags(s) MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056207 |
Locus ID | 56654 |
UniProt ID | Q9NQX5 |
Refseq Size | 1548 |
Cytogenetics | 9q34.3 |
Refseq ORF | 975 |
Synonyms | CAB; CAB-; CAB-1; CAB1; NPDC-1 |
Summary | Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414555 | NPDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414555 | Transient overexpression lysate of neural proliferation, differentiation and control, 1 (NPDC1) |
CNY 3080.00 |
|
PH301415 | NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207) |
CNY 19520.00 |
|
TP721231 | Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1) |
CNY 1800.00 |
|
TP761315 | Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |