DYNLT3 (NM_006520) Human Recombinant Protein
CAT#: TP301525L
Recombinant protein of human dynein, light chain, Tctex-type 3 (DYNLT3), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201525 protein sequence
Red=Cloning site Green=Tags(s) MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006511 |
| Locus ID | 6990 |
| UniProt ID | P51808 |
| Refseq Size | 2230 |
| Cytogenetics | Xp11.4 |
| Refseq ORF | 348 |
| Synonyms | RP3; TCTE1L; TCTEX1L |
| Summary | This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.[provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
