PPIH (NM_006347) Human Recombinant Protein
CAT#: TP301529
Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH), 20 µg
View other "PPIH" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201529 protein sequence
Red=Cloning site Green=Tags(s) MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006338 |
Locus ID | 10465 |
UniProt ID | O43447 |
Refseq Size | 813 |
Cytogenetics | 1p34.2 |
Refseq ORF | 531 |
Synonyms | CYP-20; CYPH; SnuCyp-20; USA-CYP |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416702 | PPIH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416702 | Transient overexpression lysate of peptidylprolyl isomerase H (cyclophilin H) (PPIH) |
CNY 3080.00 |
|
PH301529 | PPIH MS Standard C13 and N15-labeled recombinant protein (NP_006338) |
CNY 19520.00 |
|
TP720226 | Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH) |
CNY 1800.00 |