SGK1 (NM_005627) Human Recombinant Protein
CAT#: TP301535
Recombinant protein of human serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1, 20 µg
View other "SGK1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201535 protein sequence
Red=Cloning site Green=Tags(s) MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG FSYAPPTDSFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005618 |
| Locus ID | 6446 |
| UniProt ID | O00141 |
| Refseq Size | 2414 |
| Cytogenetics | 6q23.2 |
| Refseq ORF | 1293 |
| Synonyms | SGK |
| Summary | This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417159 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428312 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428314 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417159 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1 |
CNY 3080.00 |
|
| LY428312 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 2 |
CNY 3080.00 |
|
| LY428314 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 4 |
CNY 3080.00 |
|
| PH301535 | SGK1 MS Standard C13 and N15-labeled recombinant protein (NP_005618) |
CNY 19520.00 |
