Annexin A3 (ANXA3) (NM_005139) Human Recombinant Protein
CAT#: TP301540
Recombinant protein of human annexin A3 (ANXA3), 20 µg
View other "Annexin A3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201540 protein sequence
Red=Cloning site Green=Tags(s) MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005130 |
| Locus ID | 306 |
| UniProt ID | P12429 |
| Refseq Size | 1634 |
| Cytogenetics | 4q21.21 |
| Refseq ORF | 969 |
| Synonyms | ANX3 |
| Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417500 | ANXA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417500 | Transient overexpression lysate of annexin A3 (ANXA3) |
CNY 3080.00 |
|
| PH301540 | ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130) |
CNY 19520.00 |
|
| TP721189 | Purified recombinant protein of Human annexin A3 (ANXA3) |
CNY 1800.00 |
其它Annexin A3产品
