ELAVL1 (NM_001419) Human Recombinant Protein
CAT#: TP301562
Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1), 20 µg
View other "ELAVL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 6 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201562 protein sequence
Red=Cloning site Green=Tags(s) MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | EMSA reaction positive control (PMID: 27609814) |
| Reference Data | |
| RefSeq | NP_001410 |
| Locus ID | 1994 |
| UniProt ID | Q15717 |
| Refseq Size | 6075 |
| Cytogenetics | 19p13.2 |
| Refseq ORF | 978 |
| Synonyms | ELAV1; Hua; HUR; MelG |
| Summary | The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. [provided by RefSeq, Sep 2012] |
Citations (6)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Ultra-fast conductive media for RNA electrophoretic mobility shift assays
,Brown, SZ;Agostini, LC;Thomsett, HL;Brody, JR;,
BioTechniques
,PubMed ID 31870164
[ELAVL1]
|
|
The role of autophagy in age-related macular degeneration.
,null,
Acta ophthalmologica
,PubMed ID 29633521
[ELAVL1]
|
|
Oncogenic p95HER2 regulates Na+-HCO3- cotransporter NBCn1 mRNA stability in breast cancer cells via 3'UTR dependent processes
,Gorbatenko, A;Olesen, CW;Loebl, N;Sigurdsson, HH;Bianchi, C;Pedraz-Cuesta, E;Christiansen, J;Pedersen, SF;,
Biochem. J.
,PubMed ID 27609814
[ELAVL1]
|
|
Adenosine-to-inosine RNA editing controls cathepsin S expression in atherosclerosis by enabling HuR-mediated post-transcriptional regulation.
,null,
Nature medicine
,PubMed ID 27595325
[ELAVL1]
|
|
A Novel High Throughput Biochemical Assay to Evaluate the HuR Protein-RNA Complex Formation
,null,
PLoS ONE
,PubMed ID 23951323
[ELAVL1]
|
|
Tissue-specific control of brain-enriched miR-7 biogenesis
,Nila Roy Choudhury, Flavia de Lima Alves, Luisa de Andrés-Aguayo, Thomas Graf, Javier F. Cáceres, Juri Rappsilber, and Gracjan Michlewski,
Genes & Dev., Jan 2013; 27: 24 - 38.
[ELAVL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400549 | ELAVL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400549 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) |
CNY 3080.00 |
|
| PH301562 | ELAVL1 MS Standard C13 and N15-labeled recombinant protein (NP_001410) |
CNY 19520.00 |
