MNAT1 (NM_002431) Human Recombinant Protein
CAT#: TP301595
Recombinant protein of human menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), 20 µg
View other "MNAT1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201595 protein sequence
Red=Cloning site Green=Tags(s) MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP QDLAGGYTSSLACHRALQDAFSGLFWQPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002422 |
| Locus ID | 4331 |
| UniProt ID | P51948 |
| Refseq Size | 1397 |
| Cytogenetics | 14q23.1 |
| Refseq ORF | 927 |
| Synonyms | CAP35; MAT1; RNF66; TFB3 |
| Summary | The protein encoded by this gene, along with cyclin H and CDK7, forms the CDK-activating kinase (CAK) enzymatic complex. This complex activates several cyclin-associated kinases and can also associate with TFIIH to activate transcription by RNA polymerase II. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419334 | MNAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432796 | MNAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419334 | Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1) |
CNY 3080.00 |
|
| LY432796 | Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), transcript variant 2 |
CNY 3080.00 |
|
| PH301595 | MNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_002422) |
CNY 19520.00 |
