DNAJB6 (NM_005494) Human Recombinant Protein
CAT#: TP301620
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, 20 µg
View other "DNAJB6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201620 protein sequence
Red=Cloning site Green=Tags(s) MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE NGQERVEVEEDGQLKSLTINGKEQLLRLDNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005485 |
| Locus ID | 10049 |
| UniProt ID | O75190 |
| Refseq Size | 1568 |
| Cytogenetics | 7q36.3 |
| Refseq ORF | 723 |
| Synonyms | DJ4; DnaJ; HHDJ1; HSJ-2; HSJ2; LGMD1D; LGMD1E; LGMDD1; MRJ; MSJ-1 |
| Summary | This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409211 | DNAJB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417262 | DNAJB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409211 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 1 |
CNY 3080.00 |
|
| LY417262 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2 |
CNY 3080.00 |
|
| PH301620 | DNAJB6 MS Standard C13 and N15-labeled recombinant protein (NP_005485) |
CNY 19520.00 |
