Beclin 1 (BECN1) (NM_003766) Human Recombinant Protein
CAT#: TP301629
Recombinant protein of human beclin 1, autophagy related (BECN1), 20 µg
View other "Beclin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201629 representing NM_003766
Red=Cloning site Green=Tags(s) MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN SEEQWTKALKFMLTNLKWGLAWVSSQFYNK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 25642769) |
Reference Data | |
RefSeq | NP_003757 |
Locus ID | 8678 |
UniProt ID | Q14457 |
Refseq Size | 2144 |
Cytogenetics | 17q21.31 |
Refseq ORF | 1350 |
Synonyms | ATG6; beclin1; VPS30 |
Summary | This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of autophagy |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
A microtubule inhibitor, ABT-751, induces autophagy and delays apoptosis in Huh-7 cells.
,null,
Toxicology and applied pharmacology
,PubMed ID 27678524
[BECN1]
|
Cytosolic HMGB1 controls the cellular autophagy/apoptosis checkpoint during inflammation
,Zhu, X;Messer, JS;Wang, Y;Lin, F;Cham, CM;Chang, J;Billiar, TR;Lotze, MT;Boone, DL;Chang, EB;,
J. Clin. Invest.
,PubMed ID 25642769
[BECN1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401239 | BECN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401239 | Transient overexpression lysate of beclin 1, autophagy related (BECN1) |
CNY 3080.00 |
|
PH301629 | BECN1 MS Standard C13 and N15-labeled recombinant protein (NP_003757) |
CNY 19520.00 |
其它Beclin 1产品