CDT1 (NM_030928) Human Recombinant Protein
CAT#: TP301657
Recombinant protein of human chromatin licensing and DNA replication factor 1 (CDT1), 20 µg
View other "CDT1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 4 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201657 representing NM_030928
Red=Cloning site Green=Tags(s) MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRL RLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRAL KASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNR SETPTFAKVQRGVQDMMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEAD GAAPQLTASRLLQRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQ PPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIM SPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRAEEGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112190 |
Locus ID | 81620 |
UniProt ID | Q9H211 |
Refseq Size | 2742 |
Cytogenetics | 16q24.3 |
Refseq ORF | 1638 |
Synonyms | DUP; RIS2 |
Summary | The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. [provided by RefSeq, Mar 2011] |
Protein Families | Stem cell - Pluripotency |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
Distinct and sequential re-replication barriers ensure precise genome duplication
,null,
PLoS Genetics
,PubMed ID 32841231
[CDT1]
|
Distinct and sequential re-replication barriers ensure precise genome duplication
,Zhou, Y;Pozo, PN;Oh, S;Stone, HM;Cook, JG;,
bioRxiv
[CDT1]
|
Cdt1 stabilizes kinetochore-microtubule attachments via an Aurora B kinase-dependent mechanism
,Agarwal, S;Smith, KP;Zhou, Y;Suzuki, A;McKenney, RJ;Varma, D;,
J. Cell Biol.
,PubMed ID 30154187
[CDT1]
|
Human replication licensing factor Cdt1 directly links mitotic kinetochores to spindle microtubules
,Agarwal, S;Smith, K;Zhou, Y;Suzuki, A;McKenney, R;Varma, D;,
bioRxiv
[CDT1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403098 | CDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403098 | Transient overexpression lysate of chromatin licensing and DNA replication factor 1 (CDT1) |
CNY 3080.00 |
|
PH301657 | CDT1 MS Standard C13 and N15-labeled recombinant protein (NP_112190) |
CNY 19520.00 |