Thioredoxin 2 (TXN2) (NM_012473) Human Recombinant Protein
CAT#: TP301666
Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein, 20 µg
View other "Thioredoxin 2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201666 protein sequence
Red=Cloning site Green=Tags(s) MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK NGDVVDKFVGIKDEDQLEAFLKKLIG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036605 |
| Locus ID | 25828 |
| UniProt ID | Q99757 |
| Refseq Size | 1342 |
| Cytogenetics | 22q12.3 |
| Refseq ORF | 498 |
| Synonyms | COXPD29; MT-TRX; MTRX; TRX2; TXN |
| Summary | This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402220 | TXN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402220 | Transient overexpression lysate of thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH301666 | TXN2 MS Standard C13 and N15-labeled recombinant protein (NP_036605) |
CNY 19520.00 |
|
| TP720159 | Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |
其它Thioredoxin 2产品
