DSCC1 (NM_024094) Human Recombinant Protein
CAT#: TP301714
Recombinant protein of human defective in sister chromatid cohesion 1 homolog (S. cerevisiae) (DSCC1), 20 µg
View other "DSCC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201714 protein sequence
Red=Cloning site Green=Tags(s) MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGHSLVIRGDKDE QAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKK LLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEFDYEMKLLNHV TQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNA VKFNLAEFQEVWQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE EDIAPYIQDLCGEKQTIGALLTKYSRSSMQNGVKVYNSRRPIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076999 |
Locus ID | 79075 |
UniProt ID | Q9BVC3 |
Refseq Size | 2291 |
Cytogenetics | 8q24.12 |
Refseq ORF | 1179 |
Synonyms | DCC1 |
Summary | CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).[supplied by OMIM, Dec 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411365 | DSCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411365 | Transient overexpression lysate of defective in sister chromatid cohesion 1 homolog (S. cerevisiae) (DSCC1) |
CNY 3080.00 |
|
PH301714 | DSCC1 MS Standard C13 and N15-labeled recombinant protein (NP_076999) |
CNY 19520.00 |