HADHSC (HADH) (NM_005327) Human Recombinant Protein
CAT#: TP301752
Recombinant protein of human hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, 20 µg
View other "HADHSC" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201752 protein sequence
Red=Cloning site Green=Tags(s) MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI EESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005318 |
| Locus ID | 3033 |
| UniProt ID | Q16836 |
| Refseq Size | 1986 |
| Cytogenetics | 4q25 |
| Refseq ORF | 942 |
| Synonyms | HAD; HADH1; HADHSC; HCDH; HHF4; MSCHAD; SCHAD |
| Summary | This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. [provided by RefSeq, May 2010] |
| Protein Pathways | Butanoate metabolism, Fatty acid elongation in mitochondria, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Metabolomics and In Silico Docking-Directed Discovery of Small-Molecule Enzyme Targets
,Xu, T;Zhao, H;Wang, M;Chow, A;Fang, M;,
Analytical chemistry
,PubMed ID 33541075
[HADH]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401643 | HADH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432896 | HADH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401643 | Transient overexpression lysate of hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| LY432896 | Transient overexpression lysate of hydroxyacyl-CoA dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH301752 | HADH MS Standard C13 and N15-labeled recombinant protein (NP_005318) |
CNY 19520.00 |


