RAB7 (RAB7A) (NM_004637) Human Recombinant Protein
CAT#: TP301776
Recombinant protein of human RAB7A, member RAS oncogene family (RAB7A), 20 µg
View other "RAB7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201776 protein sequence
Red=Cloning site Green=Tags(s) MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004628 |
| Locus ID | 7879 |
| UniProt ID | P51149 |
| Refseq Size | 2240 |
| Cytogenetics | 3q21.3 |
| Refseq ORF | 621 |
| Synonyms | CMT2B; PRO2706; RAB7 |
| Summary | RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
α-Catenin levels determine direction of YAP/TAZ response to autophagy perturbation
,Pavel, M;Park, SJ;Frake, RA;Son, SM;Manni, MM;Bento, CF;Renna, M;Ricketts, T;Menzies, FM;Tanasa, R;Rubinsztein, DC;,
Nature communications
,PubMed ID 33731717
[RAB7A]
|
|
Early to Intermediate Steps of Tumor Embolic Formation Involve Specific Proteolytic Processing of E-Cadherin Regulated by Rab7
,Yin Ye, Jian-Xin Gao, Honglin Tian, Kurtis Yearsley, Alicia R. Lange, Fredika M. Robertson, and Sanford H. Barsky,
Mol. Cancer Res., Jun 2012; 10: 713 - 726.
[RAB7A]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417854 | RAB7A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417854 | Transient overexpression lysate of RAB7A, member RAS oncogene family (RAB7A) |
CNY 3080.00 |
|
| PH301776 | RAB7A MS Standard C13 and N15-labeled recombinant protein (NP_004628) |
CNY 19520.00 |
