TPD52L1 (NM_001003396) Human Recombinant Protein
CAT#: TP301816
Recombinant protein of human tumor protein D52-like 1 (TPD52L1), transcript variant 3, 20 µg
View other "TPD52L1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201816 protein sequence
Red=Cloning site Green=Tags(s) MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA MRRK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 16 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001003396 |
| Locus ID | 7164 |
| UniProt ID | Q16890 |
| Refseq Size | 1327 |
| Cytogenetics | 6q22.31 |
| Refseq ORF | 432 |
| Synonyms | D53; TPD53 |
| Summary | This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed. [provided by RefSeq, Jan 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424123 | TPD52L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424123 | Transient overexpression lysate of tumor protein D52-like 1 (TPD52L1), transcript variant 3 |
CNY 3080.00 |
|
| PH301816 | TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396) |
CNY 19520.00 |
其它TPD52L1产品
